Obre el menú principal
domini Beta-E-del blat

La metal·lotioneïna, en anglès: Metallothionein (MT), és una família de proteïnes rica en cisteïna i de baix pes molecular, dins el rang de pes molecular de 500 a 14000 Da. Es troben en les membranes de l'aparell de Golgi. Tenen la capacitat d'enllaçar fisiològicament (com el zinc, cure, seleni) i també xenobiòtica (com el cadmi, mercuri, plata, arsènic) metalibis pesants mitjançant el grup tiol. dels residus químics de la cisteïna, els quals representen prop del 30% dels residus d'aminoàcid constituents.[1]

L'MT va ser descobert l'any 1957 per Vallee i Margoshe a partir de la purificació d'una proteïna que enllaça el cadmi dins l'escorça renal del cavall.[2] La funció de l'MT no està clara però les dades experimentals suggereixen que actua contra la toxicitat dels metalls i la protecció de l'estrès oxidatiu.[3] En els humans hi ha quatre isoformes de proteïnes: MT1 (subtipus A, B, E, F, G, H, L, M, X), MT2, MT3, i MT4. En els humans grans quantitats es sintetitzen primordialment en el fetge i el ronyó. La seva producció depèn de la disponibilitat dels minerals de la histidina i la cisteïna.

PresènciaModifica

Els MTs són presents en un ampli ventall de grups taxonòmis, des de procariots, protozoa, plantes com el pèsol, blat dur, moresc, alzina surera, llevats (com Saccharomyces cerevisiae, Candida albicans,...), invertebrats (com el ematode Caenorhabditis elegans, l'insecte Drosophila melanogaster, el mol·lusc Mytilus edulis i vertebrats (com el gall, Gallus gallus, i mamífers com els humans, Homo sapiens o el ratolí Mus musculus).

Família Nom Patró de seqüència Exemple
1 Vertebrats K-x(1,2)-C-C-x-C-C-P-x(2)-C M.musculus MT1
MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCSCCPVGCAKCAQGCVCKGSSEKCRCCA
2 Mol·luscs C-x-C-x(3)-C-T-G-x(3)-C-x-C-x(3)-C-x-C-K M.edulis 10MTIV
MPAPCNCIETNVCICDTGCSGEGCRCGDACKCSGADCKCSGCKVVCKCSGSCACEGGCTGPSTCKCAPGCSCK
3 Crustacis P-[GD)-P-C-C-x(3,4)-C-x-C H.americanus MTH
MPGPCCKDKCECAEGGCKTGCKCTSCRCAPCEKCTSGCKCPSKDECAKTCSKPCKCCP
4 Equinoderms P-D-x-K-C-[V,F)-C-C-x(5)-C-x-C-x(4)-

C-C-x(4)-C-C-x(4,6)-C-C

S.purpuratus SpMTA
MPDVKCVCCKEGKECACFGQDCCKTGECCKDGTCCGICTNAACKCANGCKCGSGCSCTEGNCAC
5 Diptera C-G-x(2)-C-x-C-x(2)-Q-x(5)-C-x-C-x(2)D-C-x-C D.melanogaster MTNB
MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK
6 Nematoda K-C-C-x(3)-C-C C.elegans MT1
MACKCDCKNKQCKCGDKCECSGDKCCEKYCCEEASEKKCCPAGCKGDCKCANCHCAEQKQCGDKTHQHQGTAAAH
7 Cil·liats x-C-C-C-x ? T.termophila MTT1
MDKVNSCCCGVNAKPCCTDPNSGCCCVSKTDNCCKSDTKECCTGTGEGCKCVNCKCCKPQANCCCGVNAKPCCFDPNSGCCCVSKTNNCCKSD TKECCTGTGEGCKCTSCQCCKPVQQGCCCGDKAKACCTDPNSGCCCSNKANKCCDATSKQECQTCQCCK
8 Fongs 1 C-G-C-S-x(4)-C-x-C-x(3,4)-C-x-C-S-x-C N.crassa MT
MGDCGCSGASSCNCGSGCSCSNCGSK
9 Fongs 2 --- C.glabrata MT2
MANDCKCPNGCSCPNCANGGCQCGDKCECKKQSCHGCGEQCKCGSHGSSCHGSCGCGDKCECK
10 Fongs 3 --- C.glabrata MT2
MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQTCKCQTCKC
11 Fongs 4 C-X-K-C-x-C-x(2)-C-K-C Y.lipolitica MT3
MEFTTAMLGASLISTTSTQSKHNLVNNCCCSSSTSESSMPASCACTKCGCKTCKC
12 Fongs 5 --- S.cerevisiae CUP1
MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSGK
13 Fongs 6 --- S.cerevisiae CRS5
TVKICDCEGECCKDSCHCGSTCLPSCSGGEKCKCDHSTGSPQCKSCGEKCKCETTCTCEKSKCNCEKC
14 Procaryota K-C-A-C-x(2)-C-L-C Synechococcus sp SmtA
MTTVTQMKCACPHCLCIVSLNDAIMVDGKPYCSEVCANGTCKENSGCGHAGCGCGSA
15 Planta
15.1 Planta MTs Type 1 C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3)-spacer-C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3) Pisum sativum MT
MSGCGCGSSCNCGDSCKCNKRSSGLSYSEMETTETVILGVGPAKIQFEGAEMSAASEDGGCKCGDNCTCDPCNCK
15.2 Planta MTs Type 2 C-C-X(3)-C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3)-spacer- C-X-C-X(3)- C-X-C-X(3)- C-X-C-X(3) L.esculetum MT
MSCCGGNCGCGSSCKCGNGCGGCKMYPDMSYTESSTTTETLVLGVGPEKTSFGAMEMGESPVAENGCKCGSDCKCNPCTCSK
15.3 Planta MTs Type 3 --- A.thaliana MT3
MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEENNANCKCKCGSSCSCVNCTCCPN
15.4 Planta MTs Type 4 or Ec C-x(4)-C-X-C-X(3)-C-X(5)-C-X-C-X(9,11)-HTTCGCGEHC-

X-C-X(20)-CSCGAXCNCASC-X(3,5)

T.aestium MT
MGCNDKCGCAVPCPGGTGCRCTSARSDAAAGEHTTCGCGEHCGCNPCACGREGTPSGRANRRANCSCGAACNCASCGSTTA
99 Phytochelatins and other non-proteinaceous MT-like polypeptides --- S.pombe
γEC-γEC-γECG

.[4]


FuncionsModifica

Les funcions d'aquesta proteïna primordialment són en l'emmagatzament de metalls, transport, i desintoxicació.[5] Més específicament , el llevat MT emmagatzema el ciure i així protegeix la cèl·lula contra la toxicitat del coure quelatant els ions de coure.

Els MTs tenen un paper important en els problemes de la regulació dels factors de transcripció en el càncer.[6][7]

ReferènciesModifica

  1. Metallothioneins and Related Chelators (Metal Ions in Life Sciences). 5. Cambridge, England: Royal Society of Chemistry, 2009. ISBN 1-84755-899-2. 
  2. «A cadmium protein from equine kidney cortex». Journal of the American Chemical Society, 79, 17, 1957, pàg. 4813–4814. DOI: 10.1021/ja01574a064.
  3. «Metallothionein-3 (MT-3) in the human adrenal cortex and its disorders». Endocrine Pathology, 25, 3, 2014, pàg. 229–235. DOI: 10.1007/s12022-013-9280-9. PMID: 24242700.
  4. «Metallothioneins: classification and list of entries». www.uniprot.org.
  5. «3D solution structure of copper and silver-substituted yeast metallothioneins». FEBS Lett., 379, 1, gener 1996, pàg. 85–93. DOI: 10.1016/0014-5793(95)01492-6. PMID: 8566237.
  6. «Metallothionein--a promising tool for cancer diagnostics». Bratisl Lek Listy, 110, 2, 2009, pàg. 93–7. PMID: 19408840.
  7. Cherian, M. «Metallothioneins in human tumors and potential roles in carcinogenesis». Mutation Research/Fundamental and Molecular Mechanisms of Mutagenesis, 533, 2003, pàg. 201–209. DOI: 10.1016/j.mrfmmm.2003.07.013. PMID: 14643421.

BibliografiaModifica

Enllaços externsModifica